PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00071737001
Common NameGSBRNA2T00071737001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 284aa    MW: 30474.2 Da    PI: 7.4977
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00071737001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.62.8e-384299461
               zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                         ++lkcprC+s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  GSBRNA2T00071737001 42 HHLKCPRCNSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKRS 99
                         5789***************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-323398IPR003851Zinc finger, Dof-type
PfamPF027017.0E-334298IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5344498IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104682IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MQDIHDYSMT GGGGGGSTGR FYVGGGGGDR RMRAHQNNIL NHHLKCPRCN SLNTKFCYYN  60
NYNLSQPRHF CKNCRRYWTK GGVLRNVPVG GGCRKAKRSK PKQDQPPSSA DKSTAQEVEE  120
KSSSSESSSL TASNSTTTAA AVKVASSGFM GTDMPNIKQY GNGVVWSTLF GQGSSDGGVF  180
SEINGITAAI ETTPFGYGGS SVNQQCIGDH PKFAGNTVQQ QFGDRTAQVD PSMGFEPLDW  240
GSGGGDDQTL FDLTSTVDHS YWSQSQWTSS SDHQDDQNGL YLP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00071737001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531381e-113AK353138.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-G03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013700840.11e-173PREDICTED: dof zinc finger protein DOF5.4-like
SwissprotQ8LDR01e-120DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLA0A078HVK40.0A0A078HVK4_BRANA; BnaC02g41820D protein
STRINGBra029352.1-P1e-159(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44822656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-101OBF binding protein 4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]